Mouse Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 677 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-48T |
DL Develop |
48T |
EUR 479 |
- Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-96T |
DL Develop |
96T |
EUR 621 |
- Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-48T |
DL Develop |
48T |
EUR 508 |
- Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-96T |
DL Develop |
96T |
EUR 661 |
- Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 478 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 662 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053394 |
Abbexa |
-
EUR 6971.00
-
EUR 3714.00
-
EUR 864.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-10 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx153576 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx255205-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
ED1032-096 |
GenDepot |
96T |
EUR 928 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4391.16 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 449.27 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 598.96 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2395.32 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Mu |
Cloud-Clone |
-
EUR 4442.00
-
EUR 2346.00
-
EUR 599.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK02558 |
Abclonal |
96 Tests |
EUR 521 |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175368 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1094.00
-
EUR 537.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175369 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx132222 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1177.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 350.88
-
EUR 197.00
-
EUR 1040.80
-
EUR 413.60
-
EUR 727.20
-
EUR 298.00
-
EUR 2452.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 4329.9Da
- Isoelectric Point: 5.3
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
abx670346-1mg |
Abbexa |
1 mg |
EUR 523 |
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
20-abx652283 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651146 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651147 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651148 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490288 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx053393-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053396 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-10 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx150496 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx155127 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx256723-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
ED1031-096 |
GenDepot |
96T |
EUR 887 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4273.35 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 439.57 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 585.1 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2332.95 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: C
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Hu |
Cloud-Clone |
-
EUR 4324.00
-
EUR 2283.00
-
EUR 586.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4626.78 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 468.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 626.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
CEA864Ra-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2520.06 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Amyloid Beta Peptide 1-40 (Ab1-40) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<
- Show more
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
4-CEA864Ra |
Cloud-Clone |
-
EUR 4677.00
-
EUR 2471.00
-
EUR 627.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Amyloid Beta Peptide 1-40 elisa. Alternative names of the recognized antigen: n/a
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx361651-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx362577-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx353340-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx357155-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK00784 |
Abclonal |
96 Tests |
EUR 521 |
Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
RK03455 |
Abclonal |
96 Tests |
EUR 521 |
ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1493 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- A monoclonal antibody specific to Amyloid Beta Peptide 1-40 (A?1-40) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Amyloid Beta Peptide 1-40 (A?1-40) and unlabeled Amyloid Beta Peptide 1-4
- Show more
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu21 |
Cloud-Clone |
-
EUR 431.52
-
EUR 218.00
-
EUR 1343.20
-
EUR 514.40
-
EUR 928.80
-
EUR 352.00
-
EUR 3208.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu23 |
Cloud-Clone |
-
EUR 341.02
-
EUR 194.00
-
EUR 1003.84
-
EUR 401.28
-
EUR 702.56
-
EUR 291.00
-
EUR 2359.60
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx165634 |
Abbexa |
-
EUR 606.00
-
EUR 258.00
-
EUR 1817.00
-
EUR 718.00
-
EUR 439.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651143 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651144 |
Abbexa |
-
EUR 481.00
-
EUR 244.00
-
EUR 1372.00
-
EUR 565.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651145 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
20-abx651149 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx651150 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
20-abx651151 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490287 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
20-abx490289 |
Abbexa |
-
EUR 8569.00
-
EUR 4560.00
-
EUR 1052.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1492 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- A monoclonal antibody specific to Amyloid Beta Peptide 1-40 (A?1-40) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Amyloid Beta Peptide 1-40 (A?1-40) and unlabeled Amyloid Beta Peptide 1-4
- Show more
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40) |
ELK1494 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- A monoclonal antibody specific to Amyloid Beta Peptide 1-40 (A?1-40) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Amyloid Beta Peptide 1-40 (A?1-40) and unlabeled Amyloid Beta Peptide 1-4
- Show more
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat) |
4-PAA864Ra08 |
Cloud-Clone |
-
EUR 243.00
-
EUR 2457.00
-
EUR 613.00
-
EUR 305.00
-
EUR 212.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40) |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit |
STJ150003 |
St John's Laboratory |
1 kit |
EUR 412 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC |
4-PAA864Ra08-APC |
Cloud-Clone |
-
EUR 340.00
-
EUR 3203.00
-
EUR 894.00
-
EUR 432.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated |
4-PAA864Ra08-Biotin |
Cloud-Clone |
-
EUR 307.00
-
EUR 2407.00
-
EUR 714.00
-
EUR 375.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3 |
4-PAA864Ra08-Cy3 |
Cloud-Clone |
-
EUR 411.00
-
EUR 4229.00
-
EUR 1151.00
-
EUR 535.00
-
EUR 248.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC |
4-PAA864Ra08-FITC |
Cloud-Clone |
-
EUR 292.00
-
EUR 2582.00
-
EUR 735.00
-
EUR 366.00
-
EUR 194.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP |
4-PAA864Ra08-HRP |
Cloud-Clone |
-
EUR 311.00
-
EUR 2792.00
-
EUR 791.00
-
EUR 391.00
-
EUR 205.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE |
4-PAA864Ra08-PE |
Cloud-Clone |
-
EUR 292.00
-
EUR 2582.00
-
EUR 735.00
-
EUR 366.00
-
EUR 194.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE. |
Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit |
STJ150127 |
St John's Laboratory |
1 kit |
EUR 412 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7 |
4-PAA864Ra08-APC-Cy7 |
Cloud-Clone |
-
EUR 560.00
-
EUR 6286.00
-
EUR 1669.00
-
EUR 745.00
-
EUR 315.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: CPA864Ra21-OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7. |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-02744M1 |
ChemNorm |
96T |
EUR 461 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-02744M2 |
ChemNorm |
48T |
EUR 310 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0318MS-48T |
GenAsia Biotech |
48T |
EUR 336 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0318MS-96T |
GenAsia Biotech |
96T |
EUR 534 |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08300m-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08300m |
Cusabio |
-
EUR 946.00
-
EUR 5782.00
-
EUR 3060.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-00638R1 |
ChemNorm |
96T |
EUR 481 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-00638R2 |
ChemNorm |
48T |
EUR 332 |
Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-01866R1 |
ChemNorm |
96T |
EUR 494 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-03356H1 |
ChemNorm |
96T |
EUR 454 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-03356H2 |
ChemNorm |
48T |
EUR 303 |
Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
CN-05164H1 |
ChemNorm |
96T |
EUR 464 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0029RB-48T |
GenAsia Biotech |
48T |
EUR 326 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0029RB-96T |
GenAsia Biotech |
96T |
EUR 524 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E1247HM-48T |
GenAsia Biotech |
48T |
EUR 289 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E1247HM-96T |
GenAsia Biotech |
96T |
EUR 466 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0086PC-48T |
GenAsia Biotech |
48T |
EUR 364 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
GA-E0086PC-96T |
GenAsia Biotech |
96T |
EUR 590 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0101RT-48T |
GenAsia Biotech |
48T |
EUR 317 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
GA-E0101RT-96T |
GenAsia Biotech |
96T |
EUR 496 |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
E03A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat beta-40(Amyloid Beta 1-40) ELISA Kit |
STJ150091 |
St John's Laboratory |
1 kit |
EUR 412 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
Abeta 40 (beta amyloid 1-40) |
RA25009 |
Neuromics |
100 ul |
EUR 383 |
Human amyloid beta peptide 1-40,A?1-40 ELISA Kit |
201-12-1231 |
SunredBio |
96 tests |
EUR 440 |
- This amyloid beta peptide 1-40 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08299h-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08299h |
Cusabio |
-
EUR 900.00
-
EUR 5476.00
-
EUR 2900.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08302r-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08302r |
Cusabio |
-
EUR 967.00
-
EUR 5925.00
-
EUR 3134.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
FUNNEL, 40 MM, PP |
6120P-40 |
CORNING |
24/pk |
EUR 44 |
Description: Reusable Plastics; Reusable Funnels |
Amyloid Beta-Peptide (1-40) (human) |
A1124-10 |
ApexBio |
10 mg |
EUR 746 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-25 |
ApexBio |
25 mg |
EUR 1024 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-5 |
ApexBio |
5 mg |
EUR 467 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
E02A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
E04A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
E06A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
E01A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
E09A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Equine amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864ELA-Eq |
Lifescience Market |
96 Tests |
EUR 928 |
Monkey amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864Mo |
Lifescience Market |
96 Tests |
EUR 928 |
Rabbit amyloid beta peptide 1- 40 ELISA Kit |
ELA-E0864Rb |
Lifescience Market |
96 Tests |
EUR 928 |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
E08A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
E07A0910-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
DLR-Ab1-42-Mu-48T |
DL Develop |
48T |
EUR 489 |
- Should the Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Mouse Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit