Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit

Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T	DL Develop	48T	EUR 586.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T	DL Develop	96T	EUR 762
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 794.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 812.4

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests	Reddot Biotech	48 Tests	EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests	Reddot Biotech	96 Tests	EUR 830.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests	Reddot Biotech	48 Tests	EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests	Reddot Biotech	96 Tests	EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx155127	Abbexa	EUR 8684.40 EUR 4626.00 EUR 1074.00	10 × 96 tests 5 × 96 tests 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx053396	Abbexa	EUR 8684.40 EUR 4626.00 EUR 1074.00	10 × 96 tests 5 × 96 tests 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx256723-96tests	Abbexa	96 tests	EUR 801.6

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Ra-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5552.14
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Ra-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 562.42
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Ra-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 752.02
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Ra-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 3024.07
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
4-CEA864Ra	Cloud-Clone	EUR 5612.40 EUR 2965.20 EUR 752.40	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)
RK03455	Abclonal	96 Tests	EUR 625.2

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx132222	Abbexa	EUR 510.00 EUR 159.60 EUR 1412.40 EUR 693.60 EUR 393.60	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175368	Abbexa	EUR 477.60 EUR 159.60 EUR 1312.80 EUR 644.40 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175369	Abbexa	EUR 493.20 EUR 159.60 EUR 1362.00 EUR 661.20 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
4-SPA864Hu02	Cloud-Clone	EUR 421.06 EUR 236.40 EUR 1248.96 EUR 496.32 EUR 872.64 EUR 357.60 EUR 2942.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
20-abx652283	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
abx670346-1mg	Abbexa	1 mg	EUR 627.6

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)
20-abx651149	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)
20-abx651150	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)
20-abx651151	Abbexa	EUR 410.40 EUR 260.40 EUR 1078.80 EUR 493.20 EUR 326.40	100 ug 10 ug 1 mg 200 ug 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit
20-abx490289	Abbexa	EUR 10282.80 EUR 5472.00 EUR 1262.40	10 × 96 tests 5 × 96 tests 96 tests

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx150496	Abbexa	EUR 7970.40 EUR 4250.40 EUR 990.00	10 × 96 tests 5 × 96 tests 96 tests

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx153576	Abbexa	EUR 7970.40 EUR 4250.40 EUR 990.00	10 × 96 tests 5 × 96 tests 96 tests

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx053393-96tests	Abbexa	96 tests	EUR 801.6

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
20-abx053394	Abbexa	EUR 8365.20 EUR 4456.80 EUR 1036.80	10 × 96 tests 5 × 96 tests 96 tests

Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx357155-96tests	Abbexa	96 tests	EUR 990

Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx361651-96tests	Abbexa	96 tests	EUR 990

Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx362577-96tests	Abbexa	96 tests	EUR 990

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx255205-96tests	Abbexa	96 tests	EUR 801.6

Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
abx353340-96tests	Abbexa	96 tests	EUR 990

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5128.02
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 527.48
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 702.12
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2799.54
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
4-CEA864Hu	Cloud-Clone	EUR 5188.80 EUR 2739.60 EUR 703.20	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5269.39
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 539.12
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 718.75
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
CEA864Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2874.38
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
4-CEA864Mu	Cloud-Clone	EUR 5330.40 EUR 2815.20 EUR 718.80	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
ED1031-096	GenDepot	96T	EUR 1064.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
ED1032-096	GenDepot	96T	EUR 1113.6

Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)
RK00784	Abclonal	96 Tests	EUR 625.2

Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)
RK02558	Abclonal	96 Tests	EUR 625.2

ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40)
ELK1494	ELK Biotech	1 plate of 96 wells	EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu21	Cloud-Clone	EUR 517.82 EUR 261.60 EUR 1611.84 EUR 617.28 EUR 1114.56 EUR 422.40 EUR 3849.60	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu23	Cloud-Clone	EUR 409.22 EUR 232.80 EUR 1204.61 EUR 481.54 EUR 843.07 EUR 349.20 EUR 2831.52	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu21	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra11	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra21	Cloud-Clone	EUR 266.23 EUR 194.40 EUR 668.35 EUR 302.78 EUR 485.57 EUR 253.20 EUR 1490.88	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra31	Cloud-Clone	EUR 295.26 EUR 202.80 EUR 777.22 EUR 339.07 EUR 558.14 EUR 272.40 EUR 1763.04	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat)
4-PAA864Ra08	Cloud-Clone	EUR 291.60 EUR 2948.40 EUR 735.60 EUR 366.00 EUR 254.40	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40)

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)
20-abx165634	Abbexa	EUR 727.20 EUR 309.60 EUR 2180.40 EUR 861.60 EUR 526.80	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)
20-abx651143	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)
20-abx651144	Abbexa	EUR 577.20 EUR 292.80 EUR 1646.40 EUR 678.00 EUR 410.40	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)
20-abx651145	Abbexa	EUR 410.40 EUR 260.40 EUR 1078.80 EUR 493.20 EUR 326.40	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)
20-abx651146	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)
20-abx651147	Abbexa	EUR 376.80 EUR 243.60 EUR 927.60 EUR 410.40 EUR 309.60	100 ug 10 ug 1 mg 200 ug 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)
20-abx651148	Abbexa	EUR 410.40 EUR 260.40 EUR 1078.80 EUR 493.20 EUR 326.40	100 ug 10 ug 1 mg 200 ug 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit
20-abx490287	Abbexa	EUR 9567.60 EUR 5095.20 EUR 1177.20	10 × 96 tests 5 × 96 tests 96 tests

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit
20-abx490288	Abbexa	EUR 9567.60 EUR 5095.20 EUR 1177.20	10 × 96 tests 5 × 96 tests 96 tests

ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40)
ELK1492	ELK Biotech	1 plate of 96 wells	EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40)
ELK1493	ELK Biotech	1 plate of 96 wells	EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC
4-PAA864Ra08-APC	Cloud-Clone	EUR 408.00 EUR 3843.60 EUR 1072.80 EUR 518.40 EUR 260.40	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated
4-PAA864Ra08-Biotin	Cloud-Clone	EUR 368.40 EUR 2888.40 EUR 856.80 EUR 450.00 EUR 260.40	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3
4-PAA864Ra08-Cy3	Cloud-Clone	EUR 493.20 EUR 5074.80 EUR 1381.20 EUR 642.00 EUR 297.60	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC
4-PAA864Ra08-FITC	Cloud-Clone	EUR 350.40 EUR 3098.40 EUR 882.00 EUR 439.20 EUR 232.80	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP
4-PAA864Ra08-HRP	Cloud-Clone	EUR 373.20 EUR 3350.40 EUR 949.20 EUR 469.20 EUR 246.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE
4-PAA864Ra08-PE	Cloud-Clone	EUR 350.40 EUR 3098.40 EUR 882.00 EUR 439.20 EUR 232.80	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE.

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7
4-PAA864Ra08-APC-Cy7	Cloud-Clone	EUR 672.00 EUR 7543.20 EUR 2002.80 EUR 894.00 EUR 378.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08302r	Cusabio	EUR 1160.40 EUR 7110.00 EUR 3760.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit
STJ150003	St John's Laboratory	1 kit	EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit
STJ150127	St John's Laboratory	1 kit	EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-01866R1	ChemNorm	96T	EUR 592.8

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E0101RT-48T	GenAsia Biotech	48T	EUR 380.4

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E0101RT-96T	GenAsia Biotech	96T	EUR 595.2

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
QY-E11552	Qayee Biotechnology	96T	EUR 433.2

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0371RA-48T	Shanghai YL Biotech	48T	EUR 465

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0371RA-96T	Shanghai YL Biotech	96T	EUR 600

Rat beta-40(Amyloid Beta 1-40) ELISA Kit
STJ150091	St John's Laboratory	1 kit	EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08299h	Cusabio	EUR 1080.00 EUR 6571.20 EUR 3480.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08300m	Cusabio	EUR 1135.20 EUR 6938.40 EUR 3672.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08302r-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-00638R1	ChemNorm	96T	EUR 577.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-00638R2	ChemNorm	48T	EUR 398.4

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-02744M1	ChemNorm	96T	EUR 553.2

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-02744M2	ChemNorm	48T	EUR 372

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-03356H1	ChemNorm	96T	EUR 544.8

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-03356H2	ChemNorm	48T	EUR 363.6

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
CN-05164H1	ChemNorm	96T	EUR 556.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E1247HM-48T	GenAsia Biotech	48T	EUR 346.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E1247HM-96T	GenAsia Biotech	96T	EUR 559.2

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E0318MS-48T	GenAsia Biotech	48T	EUR 403.2

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
GA-E0318MS-96T	GenAsia Biotech	96T	EUR 640.8

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
GA-E0029RB-48T	GenAsia Biotech	48T	EUR 391.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
GA-E0029RB-96T	GenAsia Biotech	96T	EUR 628.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
GA-E0086PC-48T	GenAsia Biotech	48T	EUR 436.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
GA-E0086PC-96T	GenAsia Biotech	96T	EUR 708

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
QY-E04414	Qayee Biotechnology	96T	EUR 433.2

Equine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
QY-E120008	Qayee Biotechnology	96T	EUR 573.6

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
QY-E20080	Qayee Biotechnology	96T	EUR 433.2

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
YLA0030CA-48T	Shanghai YL Biotech	48T	EUR 502.5

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit
YLA0030CA-96T	Shanghai YL Biotech	96T	EUR 618.75

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0171PO-48T	Shanghai YL Biotech	48T	EUR 502.5

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0171PO-96T	Shanghai YL Biotech	96T	EUR 618.75

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0422MO-48T	Shanghai YL Biotech	48T	EUR 465

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA0422MO-96T	Shanghai YL Biotech	96T	EUR 600

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA1751HU-48T	Shanghai YL Biotech	48T	EUR 435

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit
YLA1751HU-96T	Shanghai YL Biotech	96T	EUR 562.5

Rat amyloid beta peptide 1-40 ELISA kit
E02A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit
E02A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit
E02A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Abeta 40 (beta amyloid 1-40)
RA25009	Neuromics	100 ul	EUR 459.6

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit
201-12-1231	SunredBio	96 tests	EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08299h-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08300m-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit
KTE101179-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit
KTE101179-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit
KTE101179-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Amyloid Beta-Peptide (1-40) (human)
A1124-10	ApexBio	10 mg	EUR 895.2
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)
A1124-25	ApexBio	25 mg	EUR 1228.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)
A1124-5	ApexBio	5 mg	EUR 560.4
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

beta-Amyloid(40-1)
5-00456	CHI Scientific	4 x 1mg	Ask for price

beta-Amyloid (1-40), rat
5-00427	CHI Scientific	4 x 1mg	Ask for price

Rabbit amyloid beta peptide 1-40 ELISA kit
E04A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit
E04A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit
E04A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit
E09A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit
E09A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit
E09A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit
E06A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit
E06A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit
E06A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit
E08A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit
E08A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit
E08A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit
E03A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit
E03A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit
E03A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit
E01A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit
E01A0910-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit
E01A0910-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit
E07A0910-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit