Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit
 ELISA Kit) Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
DLR-Ab1-40-Mu-48T |
DL Develop |
48T |
EUR 489 |
|
|
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
DLR-Ab1-40-Mu-96T |
DL Develop |
96T |
EUR 635 |
|
|
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
 ELISA Kit) Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 478 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 662 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RD-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 489 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 677 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
 ELISA Kit) Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
20-abx053396 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx256723-96tests |
Abbexa |
96 tests |
EUR 668 |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
20-abx155127 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
) Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|
RK03455 |
Abclonal |
96 Tests |
EUR 521 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Ra-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4626.78 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Ra-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 468.68 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Ra-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 626.68 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Ra-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2520.06 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
4-CEA864Ra |
Cloud-Clone |
-
EUR 4677.00
-
EUR 2471.00
-
EUR 627.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
 Antibody) Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|
20-abx132222 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1177.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|
20-abx175368 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1094.00
-
EUR 537.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|
20-abx175369 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
) Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 350.88
-
EUR 197.00
-
EUR 1040.80
-
EUR 413.60
-
EUR 727.20
-
EUR 298.00
-
EUR 2452.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
 Peptide) Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
|
20-abx652283 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
|
abx670346-1mg |
Abbexa |
1 mg |
EUR 523 |
|
|
 Peptide (BSA)) Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|
20-abx651149 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (OVA)) Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|
20-abx651150 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (KLH)) Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|
20-abx651151 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 CLIA Kit) Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|
20-abx490289 |
Abbexa |
-
EUR 8569.00
-
EUR 4560.00
-
EUR 1052.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
20-abx150496 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
20-abx153576 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx053393-96tests |
Abbexa |
96 tests |
EUR 668 |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
20-abx053394 |
Abbexa |
-
EUR 6971.00
-
EUR 3714.00
-
EUR 864.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx255205-96tests |
Abbexa |
96 tests |
EUR 668 |
|
|
 ELISA Kit) Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx361651-96tests |
Abbexa |
96 tests |
EUR 825 |
|
|
 ELISA Kit) Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx362577-96tests |
Abbexa |
96 tests |
EUR 825 |
|
|
 ELISA Kit) Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx353340-96tests |
Abbexa |
96 tests |
EUR 825 |
|
|
 ELISA Kit) Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
abx357155-96tests |
Abbexa |
96 tests |
EUR 825 |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
ED1031-096 |
GenDepot |
96T |
EUR 887 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
ED1032-096 |
GenDepot |
96T |
EUR 928 |
) Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|
RK02558 |
Abclonal |
96 Tests |
EUR 521 |
) Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|
RK00784 |
Abclonal |
96 Tests |
EUR 521 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4273.35 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 439.57 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 585.1 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2332.95 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
4-CEA864Hu |
Cloud-Clone |
-
EUR 4324.00
-
EUR 2283.00
-
EUR 586.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4391.16 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 449.27 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 598.96 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
CEA864Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2395.32 |
|
|
|
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|
4-CEA864Mu |
Cloud-Clone |
-
EUR 4442.00
-
EUR 2346.00
-
EUR 599.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
|
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
) ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40) |
|
ELK1494 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
|
|
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
) BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Hu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
) OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Hu21 |
Cloud-Clone |
-
EUR 431.52
-
EUR 218.00
-
EUR 1343.20
-
EUR 514.40
-
EUR 928.80
-
EUR 352.00
-
EUR 3208.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
) OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Hu23 |
Cloud-Clone |
-
EUR 341.02
-
EUR 194.00
-
EUR 1003.84
-
EUR 401.28
-
EUR 702.56
-
EUR 291.00
-
EUR 2359.60
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
) KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Hu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Mu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Mu21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Mu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Ra11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Ra21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|
4-CPA864Ra31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
|
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
 Polyclonal Antibody (Rat)) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat) |
|
4-PAA864Ra08 |
Cloud-Clone |
-
EUR 243.00
-
EUR 2457.00
-
EUR 613.00
-
EUR 305.00
-
EUR 212.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40) |
 Peptide (OVA)) Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|
20-abx165634 |
Abbexa |
-
EUR 606.00
-
EUR 258.00
-
EUR 1817.00
-
EUR 718.00
-
EUR 439.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (BSA)) Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|
20-abx651143 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|
20-abx651144 |
Abbexa |
-
EUR 481.00
-
EUR 244.00
-
EUR 1372.00
-
EUR 565.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (KLH)) Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|
20-abx651145 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (BSA)) Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|
20-abx651146 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (OVA)) Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|
20-abx651147 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 Peptide (KLH)) Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|
20-abx651148 |
Abbexa |
-
EUR 342.00
-
EUR 217.00
-
EUR 899.00
-
EUR 411.00
-
EUR 272.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
|
|
 CLIA Kit) Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|
20-abx490287 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
 CLIA Kit) Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|
20-abx490288 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
|
) ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40) |
|
ELK1492 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
|
|
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
) ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40) |
|
ELK1493 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
|
|
|
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
 Polyclonal Antibody (Rat), APC) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC |
|
4-PAA864Ra08-APC |
Cloud-Clone |
-
EUR 340.00
-
EUR 3203.00
-
EUR 894.00
-
EUR 432.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC. |
 Polyclonal Antibody (Rat), Biotinylated) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated |
|
4-PAA864Ra08-Biotin |
Cloud-Clone |
-
EUR 307.00
-
EUR 2407.00
-
EUR 714.00
-
EUR 375.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin. |
 Polyclonal Antibody (Rat), Cy3) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3 |
|
4-PAA864Ra08-Cy3 |
Cloud-Clone |
-
EUR 411.00
-
EUR 4229.00
-
EUR 1151.00
-
EUR 535.00
-
EUR 248.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3. |
 Polyclonal Antibody (Rat), FITC) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC |
|
4-PAA864Ra08-FITC |
Cloud-Clone |
-
EUR 292.00
-
EUR 2582.00
-
EUR 735.00
-
EUR 366.00
-
EUR 194.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC. |
 Polyclonal Antibody (Rat), HRP) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP |
|
4-PAA864Ra08-HRP |
Cloud-Clone |
-
EUR 311.00
-
EUR 2792.00
-
EUR 791.00
-
EUR 391.00
-
EUR 205.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP. |
 Polyclonal Antibody (Rat), PE) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE |
|
4-PAA864Ra08-PE |
Cloud-Clone |
-
EUR 292.00
-
EUR 2582.00
-
EUR 735.00
-
EUR 366.00
-
EUR 194.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE. |
 (human)) Amyloid Beta-Peptide (1-40) (human) |
|
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
|
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
 Polyclonal Antibody (Rat), APC-Cy7) Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7 |
|
4-PAA864Ra08-APC-Cy7 |
Cloud-Clone |
-
EUR 560.00
-
EUR 6286.00
-
EUR 1669.00
-
EUR 745.00
-
EUR 315.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
|
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7. |
ELISA Kit) Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit |
|
STJ150003 |
St John's Laboratory |
1 kit |
EUR 412 |
|
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids |
 ELISA Kit) Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit |
|
STJ150127 |
St John's Laboratory |
1 kit |
EUR 412 |
|
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids |
ELISA Kit) Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|
GA-E0101RT-48T |
GenAsia Biotech |
48T |
EUR 317 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|
GA-E0101RT-96T |
GenAsia Biotech |
96T |
EUR 496 |
 Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|
CN-01866R1 |
ChemNorm |
96T |
EUR 494 |
 ELISA Kit) Rat beta-40(Amyloid Beta 1-40) ELISA Kit |
|
STJ150091 |
St John's Laboratory |
1 kit |
EUR 412 |
|
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
 Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
|
CSB-E08302r-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
|
1-CSB-E08302r |
Cusabio |
-
EUR 967.00
-
EUR 5925.00
-
EUR 3134.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
|
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit
